General Information

  • ID:  hor000714
  • Uniprot ID:  A0A7M7GBM0??34-42)
  • Protein name:  Cardioactive peptide
  • Gene name:  NA
  • Organism:  Nasonia vitripennis (Parasitic wasp)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Nasonia (genus), Pteromalinae (subfamily), Pteromalidae (family), Chalcidoidea (superfamily), Parasitoida (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  PFCNAFTGC
  • Length:  9(34-42)
  • Propeptide:  MKVLKLVLSLLIIIESVEIARADDGLEIVAMKRPFCNAFTGCGRKRDPSYASGLQLPIPLYRALLRLSSLRNGAAAEVRMRQRPLGLIGPENLVQLGPQAPRLMAAPVVVPSLY
  • Signal peptide:  MKVLKLVLSLLIIIESVEIARA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7GBM0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000714_AF2.pdbhor000714_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 110198 Formula: C42H58N10O12S2
Absent amino acids: DEHIKLMQRSVWY Common amino acids: CF
pI: 5.84 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: 68.89 Boman Index: 206
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 11.11
Instability Index: 2085.56 Extinction Coefficient cystines: 125
Absorbance 280nm: 15.63

Literature

  • PubMed ID:  20695486
  • Title:  Genomics and Peptidomics of Neuropeptides and Protein Hormones Present in the Parasitic Wasp Nasonia Vitripennis